Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YWHAH protein

This Human YWHAH protein spans the amino acid sequence from region 4-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YWHAH YWHA1

UniProt

Q04917

Expression Region

4-246aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS4B, CT (VPS4B, SKD1, VPS42, Vacuolar protein sorting-associated protein 4B, Cell migration-inducing gene 1 protein, Suppressor of K (+) transport growth defect 1) (MaxLight 405) discontinued
043778-ML405 100 µL

VPS4B, CT (VPS4B, SKD1, VPS42, Vacuolar protein sorting-associated protein 4B, Cell migration-inducing gene 1 protein, Suppressor of K (+) transport growth defect 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RB antibody (Thr821)
70R-33423 100 ug

RB antibody (Thr821)

Sign In for Pricing
View Details
Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) Antibody
abx104256-01 100 µL

Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) Antibody

Sign In for Pricing
View Details
Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) Antibody
abx104256-02 200 µL

Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) Antibody

Sign In for Pricing
View Details
Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) Antibody
abx104256-03 1 mL

Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) Antibody

Sign In for Pricing
View Details
Porcine PRL ELISA Kit
orb441751-01 48 Tests

Porcine PRL ELISA Kit

Sign In for Pricing
View Details