Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAM15 protein

This Human ADAM15 protein spans the amino acid sequence from region 207-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADAM15 MDC15

UniProt

Q13444

Expression Region

207-452aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIEN1 Protein Vector (Rat) (pPM-C-HA)
28592026 500 ng

MIEN1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
STK25 (NM_001282305) Human Tagged ORF Clone
RC237501 10 µg

STK25 (NM_001282305) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal ZMYM3 Antibody [PerCP]
NBP1-76525PCP 0.1 mL

Rabbit Polyclonal ZMYM3 Antibody [PerCP]

Sign In for Pricing
View Details
Recombinant Human CD44 protein, N-His Tag, OVA Conjugated
IMP-2660 10 µg

Recombinant Human CD44 protein, N-His Tag, OVA Conjugated

Sign In for Pricing
View Details
TESPA1 Polyclonal Antibody, HRP Conjugated
A62819-050 50 µL

TESPA1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Vom2r7-set siRNA/shRNA/RNAi Lentivector (Rat)
50149096 4x 500 ng

Vom2r7-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details