Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAM15 protein

This Human ADAM15 protein spans the amino acid sequence from region 207-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADAM15 MDC15

UniProt

Q13444

Expression Region

207-452aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INDOL1 Antibody
orb1316358 100 µL

INDOL1 Antibody

Sign In for Pricing
View Details
NUDT7 Rabbit Polyclonal Antibody
orb512756 100 µg

NUDT7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Coxiella burnetii NADH-quinone oxidoreductase subunit K (nuoK)
orb2934734-01 20 µg

Recombinant Coxiella burnetii NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii NADH-quinone oxidoreductase subunit K (nuoK)
orb2934734-02 100 µg

Recombinant Coxiella burnetii NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Anti-Human CD11c/ITGAX Monoclonal Antibody (1A663)
HB666025-01 50 µg

Anti-Human CD11c/ITGAX Monoclonal Antibody (1A663)

Sign In for Pricing
View Details
Anti-Human CD11c/ITGAX Monoclonal Antibody (1A663)
HB666025-02 100 µg

Anti-Human CD11c/ITGAX Monoclonal Antibody (1A663)

Sign In for Pricing
View Details