Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CALML5 protein

This Human CALML5 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CALML5

UniProt

Q9NZT1

Expression Region

2-146aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparanase / HPSE (36-543, His-tag) Human Protein
AR51384PU-N 500 µg

Heparanase / HPSE (36-543, His-tag) Human Protein

Sign In for Pricing
View Details
T2 Mouse siRNA Oligo Duplex (Locus ID 21331)
SR403387 1 Kit

T2 Mouse siRNA Oligo Duplex (Locus ID 21331)

Sign In for Pricing
View Details
C21orf67 3'UTR Luciferase Stable Cell Line
TU003267 1.0 mL

C21orf67 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZNF175 Human Over-expression Lysate
orb1347363 100 µg

ZNF175 Human Over-expression Lysate

Sign In for Pricing
View Details
Arsenic Concentrate 10PPM Grade 1
5000500C 100 mL

Arsenic Concentrate 10PPM Grade 1

Sign In for Pricing
View Details
Trk B
338200 100 µL

Trk B

Sign In for Pricing
View Details