Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CALML5 protein

This Human CALML5 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CALML5

UniProt

Q9NZT1

Expression Region

2-146aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Calreticulin Antibody (SAIC-16D-6B9) [PerCP]
NBP3-20094PCP 0.1 mL

Rabbit Monoclonal Calreticulin Antibody (SAIC-16D-6B9) [PerCP]

Sign In for Pricing
View Details
Mouse Slc35a2 activation kit by CRISPRa
GA204534 1 Kit

Mouse Slc35a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat TTR (Transthyretin) ELISA Kit
ELK10618-01 48 Tests

Rat TTR (Transthyretin) ELISA Kit

Sign In for Pricing
View Details
Rat TTR (Transthyretin) ELISA Kit
ELK10618-02 96 Tests

Rat TTR (Transthyretin) ELISA Kit

Sign In for Pricing
View Details
Rat TTR (Transthyretin) ELISA Kit
ELK10618-03 5x 96 Tests

Rat TTR (Transthyretin) ELISA Kit

Sign In for Pricing
View Details
Suvizumab ELISA Kit
KET-10798 96 Tests

Suvizumab ELISA Kit

Sign In for Pricing
View Details