Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CALML5 protein

This Human CALML5 protein spans the amino acid sequence from region 2-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CALML5

UniProt

Q9NZT1

Expression Region

2-146aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHV1OR15-6 3'UTR Lenti-reporter-Luc Vector
24418081 1.0 µg

IGHV1OR15-6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri GPMI Polyclonal Antibody
MBS7160870 Inquire

Rabbit anti-Shigella flexneri GPMI Polyclonal Antibody

Sign In for Pricing
View Details
Junb sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4403507 1.0 µg DNA

Junb sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Neflumozide
HY-167875 1 Each

Neflumozide

Sign In for Pricing
View Details
Svs3b sgRNA CRISPR Lentivector set (Rat)
K6020401 3x 1.0 µg

Svs3b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
LRRC4B, NT (LRRC4B, LRIG4, Leucine-rich repeat-containing protein 4B, Netrin-G3 ligand) (Biotin)
MBS6317177-01 0.2 mL

LRRC4B, NT (LRRC4B, LRIG4, Leucine-rich repeat-containing protein 4B, Netrin-G3 ligand) (Biotin)

Sign In for Pricing
View Details