Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EMC9 protein

This Human EMC9 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EMC9

UniProt

Q9Y3B6

Expression Region

1-208aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 Antibody
orb1326380 100 µg

CD86 Antibody

Sign In for Pricing
View Details
MTRF1L Adenovirus (Mouse)
31093054 1.0 mL

MTRF1L Adenovirus (Mouse)

Sign In for Pricing
View Details
VLOEIBARELUCHT450X52RL-T1-LL-P8 Pipe Markers for Air & Ducts
N004859 30 Pack (30 Marker (s) x 1 Roll)

VLOEIBARELUCHT450X52RL-T1-LL-P8 Pipe Markers for Air & Ducts

Sign In for Pricing
View Details
PPIG Rabbit Polyclonal Antibody
orb3129164 100 µg

PPIG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Elaphodus cephalophus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), partial
MBS7097622 Inquire

Recombinant Elaphodus cephalophus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), partial

Sign In for Pricing
View Details
Recombinant human SAA1 protein, C-hFc (HEK293), APC Conjugated
bs-43136P-APC-01 20 µg

Recombinant human SAA1 protein, C-hFc (HEK293), APC Conjugated

Sign In for Pricing
View Details