Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EMC9 protein

This Human EMC9 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EMC9

UniProt

Q9Y3B6

Expression Region

1-208aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1047 ORF Vector (Mouse) (pORF)
ORF052010 1.0 µg DNA

Olfr1047 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal p53 DINP1 Antibody [DyLight 550]
NBP1-76638R 0.1 mL

Rabbit Polyclonal p53 DINP1 Antibody [DyLight 550]

Sign In for Pricing
View Details
Rat Il10/Interleukin-10 ELISA Kit
E45K00397 96 Tests

Rat Il10/Interleukin-10 ELISA Kit

Sign In for Pricing
View Details
ETV6 / Tel Blocking Peptide
MBS9623353-01 1 mg

ETV6 / Tel Blocking Peptide

Sign In for Pricing
View Details
ETV6 / Tel Blocking Peptide
MBS9623353-02 5x 1 mg

ETV6 / Tel Blocking Peptide

Sign In for Pricing
View Details
Eefsec ORF Vector (Rat) (pORF)
ORF066369 1.0 µg DNA

Eefsec ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details