Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPP2R3B protein

This Human PPP2R3B protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPP2R3B

UniProt

Q9Y5P8

Expression Region

1-176aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PKC delta Antibody
MBS9240687-01 0.05 mL

Anti-PKC delta Antibody

Sign In for Pricing
View Details
Anti-PKC delta Antibody
MBS9240687-02 0.1 mL

Anti-PKC delta Antibody

Sign In for Pricing
View Details
Anti-PKC delta Antibody
MBS9240687-03 5x 0.1 mL

Anti-PKC delta Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Osteocalcin Antibody (2H9F11F8)
NB100-62801-0.025mg 0.025 mg

Mouse Monoclonal Osteocalcin Antibody (2H9F11F8)

Sign In for Pricing
View Details
IFluor® 540 maleimide
1427-AAT 1 mg

IFluor® 540 maleimide

Sign In for Pricing
View Details
MAD3 Overexpression Lysate (Native) - (Dry Ice)
NBL1-13407 0.1 mg

MAD3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details