Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPP2R3B protein

This Human PPP2R3B protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPP2R3B

UniProt

Q9Y5P8

Expression Region

1-176aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100G Antibody
MBS9520753-01 0.04 mL

S100G Antibody

Sign In for Pricing
View Details
S100G Antibody
MBS9520753-02 0.1 mL

S100G Antibody

Sign In for Pricing
View Details
S100G Antibody
MBS9520753-03 0.2 mL

S100G Antibody

Sign In for Pricing
View Details
S100G Antibody
MBS9520753-04 5x 0.2 mL

S100G Antibody

Sign In for Pricing
View Details
Rat Protocadherin-1 (PCDH1) ELISA Kit
YP-W31018-01 48 Tests

Rat Protocadherin-1 (PCDH1) ELISA Kit

Sign In for Pricing
View Details
Rat Protocadherin-1 (PCDH1) ELISA Kit
YP-W31018-02 96 Tests

Rat Protocadherin-1 (PCDH1) ELISA Kit

Sign In for Pricing
View Details