Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TIMM10B protein

This Human TIMM10B protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TIMM10B

UniProt

Q9Y5J6

Expression Region

1-103aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gstm1 shRNA (UAS) - Lentiviral mouse Gstm1 shRNA (UAS) (25)
GTR15295772 1 Vial

Lentiviral mouse Gstm1 shRNA (UAS) - Lentiviral mouse Gstm1 shRNA (UAS) (25)

Sign In for Pricing
View Details
PLEKHM1 Lentiviral Activation Particles (m)
sc-436131-LAC 200 µL

PLEKHM1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Exo5 / Exonuclease V ELISA Kit
MBS2905747-01 48 Well

Mouse Exo5 / Exonuclease V ELISA Kit

Sign In for Pricing
View Details
Mouse Exo5 / Exonuclease V ELISA Kit
MBS2905747-02 96 Well

Mouse Exo5 / Exonuclease V ELISA Kit

Sign In for Pricing
View Details
Mouse Exo5 / Exonuclease V ELISA Kit
MBS2905747-03 5x 96 Well

Mouse Exo5 / Exonuclease V ELISA Kit

Sign In for Pricing
View Details
Mouse Exo5 / Exonuclease V ELISA Kit
MBS2905747-04 10x 96 Well

Mouse Exo5 / Exonuclease V ELISA Kit

Sign In for Pricing
View Details