Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TIMM10B protein

This Human TIMM10B protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TIMM10B

UniProt

Q9Y5J6

Expression Region

1-103aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-GSC1 Rabbit mAb
CMA4345-01 30 µL

Recombinant Anti-GSC1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-GSC1 Rabbit mAb
CMA4345-02 50 μL

Recombinant Anti-GSC1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-GSC1 Rabbit mAb
CMA4345-03 100 µL

Recombinant Anti-GSC1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-GSC1 Rabbit mAb
CMA4345-04 200 µL

Recombinant Anti-GSC1 Rabbit mAb

Sign In for Pricing
View Details
Frozen Tissue Blocks, Muscle tissue
CB547989 1 Block

Frozen Tissue Blocks, Muscle tissue

Sign In for Pricing
View Details
Gm4906 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3760705 3x 1.0 µg

Gm4906 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details