Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MCTS1 protein

This Human MCTS1 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MCTS1

UniProt

Q9ULC4

Expression Region

1-181aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK alpha, phosphorylated (Ser176, Ser180) (IKKa, IKK1, IkappaB Kinase alpha, Conserved Helix Loop Helix Ubiquitous Kinase, CHUK1, IkappaB Kinase 1, IkB Kinase alpha, IKBKa, IKK1, Inhibitor Of kappa Light Polypeptide Gene Enhancer In B Cells, Inhibitor Of Nuclear Factor kappa B Kinase alpha, NFKBIKa, TCF16) (APC) discontinued
I3000-07M-APC 100 µL

IKK alpha, phosphorylated (Ser176, Ser180) (IKKa, IKK1, IkappaB Kinase alpha, Conserved Helix Loop Helix Ubiquitous Kinase, CHUK1, IkappaB Kinase 1, IkB Kinase alpha, IKBKa, IKK1, Inhibitor Of kappa Light Polypeptide Gene Enhancer In B Cells, Inhibitor Of Nuclear Factor kappa B Kinase alpha, NFKBIKa, TCF16) (APC) discontinued

Sign In for Pricing
View Details
TCF25 Protein Vector (Human) (pPM-C-His)
PV041544 500 ng

TCF25 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
P53 Rabbit Polyclonal Antibody
orb338999-01 30 µL

P53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P53 Rabbit Polyclonal Antibody
orb338999-02 50 μL

P53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P53 Rabbit Polyclonal Antibody
orb338999-03 100 µL

P53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P53 Rabbit Polyclonal Antibody
orb338999-04 200 µL

P53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details