Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MCTS1 protein

This Human MCTS1 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MCTS1

UniProt

Q9ULC4

Expression Region

1-181aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frataxin (FXN) Antibody
abx032828-01 80 µL

Frataxin (FXN) Antibody

Sign In for Pricing
View Details
Frataxin (FXN) Antibody
abx032828-02 400 µL

Frataxin (FXN) Antibody

Sign In for Pricing
View Details
Prss44 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6249205 3x 1.0 µg

Prss44 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
IFluor® 350 Anti-human CD135 Antibody *BV10A4*
11350011-AAT 500 Tests

IFluor® 350 Anti-human CD135 Antibody *BV10A4*

Sign In for Pricing
View Details
TBC1D24 (NM_020705) Human Tagged Lenti ORF Clone
RC210346L3 10 µg

TBC1D24 (NM_020705) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APOBEC2, NT (APOBEC2, Probable C->U-editing enzyme APOBEC-2) (Azide free) (HRP) discontinued
031978-HRP 200 µL

APOBEC2, NT (APOBEC2, Probable C->U-editing enzyme APOBEC-2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details