Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DGCR6L protein

This Human DGCR6L protein spans the amino acid sequence from region 1-220aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DGCR6L

UniProt

Q9BY27

Expression Region

1-220aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASK1 (MAP3K5) pSer966 Rabbit Polyclonal Antibody
AP01527PU-N 100 µg

ASK1 (MAP3K5) pSer966 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymphoid tissue
CP565850 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), Biotin conjugate, 0.1mg/mL
BNCB2988-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GMDS (NM_001500) Human Over-expression Lysate
LC419903 20 µg

GMDS (NM_001500) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant THBS1 Antibody
RC-5946-01 50 μL

Recombinant THBS1 Antibody

Sign In for Pricing
View Details
Recombinant THBS1 Antibody
RC-5946-02 100 µL

Recombinant THBS1 Antibody

Sign In for Pricing
View Details