Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DGCR6L protein

This Human DGCR6L protein spans the amino acid sequence from region 1-220aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DGCR6L

UniProt

Q9BY27

Expression Region

1-220aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP1 Recombinant Rabbit monoclonal Antibody
HA751160 100 µL

LAMP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Interleukin 2 (IL2) ELISA Kit
RD-IL2-Hu-01 96 Tests

Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 2 (IL2) ELISA Kit
RD-IL2-Hu-02 48 Tests

Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
C12orf70 (SMCO2) Human Gene Knockout Kit (CRISPR)
KN427692 1 Kit

C12orf70 (SMCO2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAT8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H3]
TA500530BM 100 µL

NAT8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H3]

Sign In for Pricing
View Details
MURF2 (TRIM55) Human Gene Knockout Kit (CRISPR)
KN402934 1 Kit

MURF2 (TRIM55) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details