Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFT27 protein

This Human IFT27 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFT27

UniProt

Q9BW83

Expression Region

1-186aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (PE)
252165-PE 100 µL

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (PE)

Sign In for Pricing
View Details
Rat Monoclonal mouse NKp46 Antibody
orb1408213-01 100 µg

Rat Monoclonal mouse NKp46 Antibody

Sign In for Pricing
View Details
Rat Monoclonal mouse NKp46 Antibody
orb1408213-02 50 µg

Rat Monoclonal mouse NKp46 Antibody

Sign In for Pricing
View Details
Rat TAOK2 (Serine/threonine-protein kinase TAO2) ELISA Kit
ELK8551-01 48 Tests

Rat TAOK2 (Serine/threonine-protein kinase TAO2) ELISA Kit

Sign In for Pricing
View Details
Rat TAOK2 (Serine/threonine-protein kinase TAO2) ELISA Kit
ELK8551-02 96 Tests

Rat TAOK2 (Serine/threonine-protein kinase TAO2) ELISA Kit

Sign In for Pricing
View Details
Rat TAOK2 (Serine/threonine-protein kinase TAO2) ELISA Kit
ELK8551-03 5x 96 Tests

Rat TAOK2 (Serine/threonine-protein kinase TAO2) ELISA Kit

Sign In for Pricing
View Details