Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFT27 protein

This Human IFT27 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFT27

UniProt

Q9BW83

Expression Region

1-186aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OATA00177-25T - Human CD2 Antibody : FITC
OATA00177-25T 25 Tests

OATA00177-25T - Human CD2 Antibody : FITC

Sign In for Pricing
View Details
Mouse Janus Kinase 3 (JAK3) ELISA Kit
DL-JAK3-Mu-01 48 Tests

Mouse Janus Kinase 3 (JAK3) ELISA Kit

Sign In for Pricing
View Details
Mouse Janus Kinase 3 (JAK3) ELISA Kit
DL-JAK3-Mu-02 96 Tests

Mouse Janus Kinase 3 (JAK3) ELISA Kit

Sign In for Pricing
View Details
Chlamydia species LPS Antibody
orb23893 1 mg

Chlamydia species LPS Antibody

Sign In for Pricing
View Details
Anti-ABCA8 antibody
STJ71602 100 µg

Anti-ABCA8 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SARS-CoV-2 ORF3b Antibody [DyLight 594]
NBP3-11929DL594 0.1 mL

Rabbit Polyclonal SARS-CoV-2 ORF3b Antibody [DyLight 594]

Sign In for Pricing
View Details