Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFT27 protein

This Human IFT27 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFT27

UniProt

Q9BW83

Expression Region

1-186aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubr2 (NM_001178071) Rat Tagged ORF Clone
RR217688 10 µg

Ubr2 (NM_001178071) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse DYNC1H1 siRNA
abx914798-01 15 nmol

Mouse DYNC1H1 siRNA

Sign In for Pricing
View Details
Mouse DYNC1H1 siRNA
abx914798-02 30 nmol

Mouse DYNC1H1 siRNA

Sign In for Pricing
View Details
ESF1 siRNA (Mouse)
orb1842580-01 15 nmol

ESF1 siRNA (Mouse)

Sign In for Pricing
View Details
ESF1 siRNA (Mouse)
orb1842580-02 30 nmol

ESF1 siRNA (Mouse)

Sign In for Pricing
View Details
IkB beta discontinued
510556 100 µg

IkB beta discontinued

Sign In for Pricing
View Details