Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASB6 protein

This Human ASB6 protein spans the amino acid sequence from region 1-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASB6

UniProt

Q9NWX5

Expression Region

1-197aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr157 Protein Vector (Mouse) (pPM-C-HA)
PV209636 500 ng

Olfr157 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HNF4A/HNF4G Antibody
CSB-PA002940-01 50 µg

HNF4A/HNF4G Antibody

Sign In for Pricing
View Details
HNF4A/HNF4G Antibody
CSB-PA002940-02 100 µg

HNF4A/HNF4G Antibody

Sign In for Pricing
View Details
Recombinant Human CD200R1 Protein (Fc Tag)
PKSH032207-01 10 µg

Recombinant Human CD200R1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD200R1 Protein (Fc Tag)
PKSH032207-02 50 µg

Recombinant Human CD200R1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg UPF0270 protein YheU (yheU)
MBS1158676-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg UPF0270 protein YheU (yheU)

Sign In for Pricing
View Details