Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DYNLRB1 protein

This Human DYNLRB1 protein spans the amino acid sequence from region 3-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DYNLRB1

UniProt

Q9NP97

Expression Region

3-96aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flexible Tube Tygon® LP-1200, ID = 6.35 mm, OD = 9.53 mm, Tube length = 15 m, made of thermoplastic elastomer
1462304 15 PK

Flexible Tube Tygon® LP-1200, ID = 6.35 mm, OD = 9.53 mm, Tube length = 15 m, made of thermoplastic elastomer

Sign In for Pricing
View Details
ROR1, Human (141a.a, HEK293, His)
HY-P704868 50 µg

ROR1, Human (141a.a, HEK293, His)

Sign In for Pricing
View Details
EPAS1 Polyclonal Antibody
MBS2539987-01 0.06 mL

EPAS1 Polyclonal Antibody

Sign In for Pricing
View Details
EPAS1 Polyclonal Antibody
MBS2539987-02 0.12 mL

EPAS1 Polyclonal Antibody

Sign In for Pricing
View Details
EPAS1 Polyclonal Antibody
MBS2539987-03 0.2 mL

EPAS1 Polyclonal Antibody

Sign In for Pricing
View Details
EPAS1 Polyclonal Antibody
MBS2539987-04 5x 0.2 mL

EPAS1 Polyclonal Antibody

Sign In for Pricing
View Details