Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CINP protein

This Human CINP protein spans the amino acid sequence from region 1-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CINP

UniProt

Q9BW66

Expression Region

1-212aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAS26 Protein Vector (Human) (pPM-C-HA)
PV140204 500 ng

TRNAS26 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Jmv 180
T32297 25 mg

Jmv 180

Sign In for Pricing
View Details
EZH1 antibody
FNab02917 100 µg

EZH1 antibody

Sign In for Pricing
View Details
GPR178 HDR Plasmid (h)
sc-412843-HDR 20 µg

GPR178 HDR Plasmid (h)

Sign In for Pricing
View Details
Mmu-miR-29c-5p miRNA Mimic
CMM0423-01 5 nmol

Mmu-miR-29c-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-29c-5p miRNA Mimic
CMM0423-02 10 nmol

Mmu-miR-29c-5p miRNA Mimic

Sign In for Pricing
View Details