Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RARRES2 protein

This Human RARRES2 protein spans the amino acid sequence from region 21-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RARRES2

UniProt

Q99969

Expression Region

21-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Molybdenum cofactor sulfurase (MOCOS) , partial
MBS1307072 Inquire

Recombinant Bovine Molybdenum cofactor sulfurase (MOCOS) , partial

Sign In for Pricing
View Details
COX8A Protein Vector (Mouse) (pPM-C-HA)
16726024 500 ng

COX8A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Nova1 (NM_021361) Mouse Tagged ORF Clone
MR225500 10 µg

Nova1 (NM_021361) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LRP1B Recombinant Protein
OPCD00373-50UG 50 µg

LRP1B Recombinant Protein

Sign In for Pricing
View Details
Hoxb4 ORF Vector (Mouse) (pORF)
ORF047400 1.0 µg DNA

Hoxb4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
LEPR Antibody
A17169-50UG 50 µg

LEPR Antibody

Sign In for Pricing
View Details