Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RARRES2 protein

This Human RARRES2 protein spans the amino acid sequence from region 21-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RARRES2

UniProt

Q99969

Expression Region

21-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR4 Antibody
OACD03192-1ML 1 mL

EGR4 Antibody

Sign In for Pricing
View Details
TrkB Rabbit pAb
A2099-01 20 µL

TrkB Rabbit pAb

Sign In for Pricing
View Details
TrkB Rabbit pAb
A2099-02 100 μL

TrkB Rabbit pAb

Sign In for Pricing
View Details
TrkB Rabbit pAb
A2099-03 500 μL

TrkB Rabbit pAb

Sign In for Pricing
View Details
TrkB Rabbit pAb
A2099-04 1000 μL

TrkB Rabbit pAb

Sign In for Pricing
View Details
Cenpi ORF Vector (Mouse) (pORF)
15876014 1.0 µg DNA

Cenpi ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details