Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli NFYA3 protein

This E.coli NFYA3 protein spans the amino acid sequence from region 1-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NFYA3

UniProt

Q93ZH2

Expression Region

1-340aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pleckstrin homology-Like domain family A member 3 (PHLDA3) Rat ELISA Kit
F9696 96 Tests

Pleckstrin homology-Like domain family A member 3 (PHLDA3) Rat ELISA Kit

Sign In for Pricing
View Details
Neuregulin-3 Antibody
OM636748-01 100 µL

Neuregulin-3 Antibody

Sign In for Pricing
View Details
Neuregulin-3 Antibody
OM636748-02 20 µL

Neuregulin-3 Antibody

Sign In for Pricing
View Details
Neuregulin-3 Antibody
OM636748-03 50 µL

Neuregulin-3 Antibody

Sign In for Pricing
View Details
P53 Rabbit pAb Antibody
orb763704-01 50 μL

P53 Rabbit pAb Antibody

Sign In for Pricing
View Details
P53 Rabbit pAb Antibody
orb763704-02 100 µL

P53 Rabbit pAb Antibody

Sign In for Pricing
View Details