Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL20 protein

This Bovine CCL20 protein spans the amino acid sequence from region 27-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL20

UniProt

Q8SQB1

Expression Region

27-96aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUFY4 Antibody, Biotin conjugated
A58678-100UG 100 µg

RUFY4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human Serine peptidase inhibitors K1 ELISA kit
GTR10475533 96 Well

Human Serine peptidase inhibitors K1 ELISA kit

Sign In for Pricing
View Details
Rat Beta-Thromboglobulin (Beta-TG) ELISA Kit
SL0769Ra-01 48 Tests

Rat Beta-Thromboglobulin (Beta-TG) ELISA Kit

Sign In for Pricing
View Details
Rat Beta-Thromboglobulin (Beta-TG) ELISA Kit
SL0769Ra-02 96 Tests

Rat Beta-Thromboglobulin (Beta-TG) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SAMM50 Protein - (Dry Ice)
H00025813-P01-10ug 10 µg

Recombinant Human SAMM50 Protein - (Dry Ice)

Sign In for Pricing
View Details
8-Br-GTP tetrasodium
T212438-01 10 mg

8-Br-GTP tetrasodium

Sign In for Pricing
View Details