Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Serpina3n protein

This Mouse Serpina3n protein spans the amino acid sequence from region 21-418aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpina3n

UniProt

Q91WP6

Expression Region

21-418aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TASP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV629378 1.0 µg DNA

TASP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
F-Box Protein 45 (FBXO45) Antibody
abx122746-01 100 µg

F-Box Protein 45 (FBXO45) Antibody

Sign In for Pricing
View Details
F-Box Protein 45 (FBXO45) Antibody
abx122746-02 1 mg

F-Box Protein 45 (FBXO45) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Evx1 Antibody (3F4)
H00002128-M04 0.1 mg

Mouse Monoclonal Evx1 Antibody (3F4)

Sign In for Pricing
View Details
MOBKL2C ORF Vector (Human) (pORF)
30288012 1.0 µg DNA

MOBKL2C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RPS10P11 CRISPRa sgRNA lentivector (set of three targets)(Human)
42015121 3x 1.0µg DNA

RPS10P11 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details