Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Serpina3n protein

This Mouse Serpina3n protein spans the amino acid sequence from region 21-418aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpina3n

UniProt

Q91WP6

Expression Region

21-418aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin A/CSTA Rabbit Polyclonal Antibody (APC)
orb2575322 100 µg

Cystatin A/CSTA Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Prlh 3'UTR Luciferase Stable Cell Line
TU216816 1.0 mL

Prlh 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Drosophila virilis Ubiquitin carboxyl-terminal hydrolase 36 (Usp36), partial
MBS1237871 Inquire

Recombinant Drosophila virilis Ubiquitin carboxyl-terminal hydrolase 36 (Usp36), partial

Sign In for Pricing
View Details
MGMT Mouse Monoclonal Antibody [Clone ID: UMLBI52]
AMM21858VCF 100 µg

MGMT Mouse Monoclonal Antibody [Clone ID: UMLBI52]

Sign In for Pricing
View Details
Prl4a1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV696692 1.0 µg DNA

Prl4a1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Anti-Human HLA-G Antibody (38375#)
RHM00626 100 μg

Anti-Human HLA-G Antibody (38375#)

Sign In for Pricing
View Details