Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ST8SIA4 protein

This Human ST8SIA4 protein spans the amino acid sequence from region 21-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ST8SIA4

UniProt

Q92187

Expression Region

21-168aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thioredoxin / TRX (TXN) Antibody
abx170966-01 100 µL

Thioredoxin / TRX (TXN) Antibody

Sign In for Pricing
View Details
Thioredoxin / TRX (TXN) Antibody
abx170966-02 200 µL

Thioredoxin / TRX (TXN) Antibody

Sign In for Pricing
View Details
Thioredoxin / TRX (TXN) Antibody
abx170966-03 1 mL

Thioredoxin / TRX (TXN) Antibody

Sign In for Pricing
View Details
Human Rho GTPase-activating protein 21, ARHGAP21 ELISA Kit
MBS9336806-01 48 Well

Human Rho GTPase-activating protein 21, ARHGAP21 ELISA Kit

Sign In for Pricing
View Details
Human Rho GTPase-activating protein 21, ARHGAP21 ELISA Kit
MBS9336806-02 96 Well

Human Rho GTPase-activating protein 21, ARHGAP21 ELISA Kit

Sign In for Pricing
View Details
Human Rho GTPase-activating protein 21, ARHGAP21 ELISA Kit
MBS9336806-03 5x 96 Well

Human Rho GTPase-activating protein 21, ARHGAP21 ELISA Kit

Sign In for Pricing
View Details