Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD300LF protein

This Human CD300LF protein spans the amino acid sequence from region 20-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD300LF

UniProt

Q8TDQ1

Expression Region

20-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CLDN18.2 Antibody (SAA0138), PE
MBS1584382-01 50 Tests

Anti-Human CLDN18.2 Antibody (SAA0138), PE

Sign In for Pricing
View Details
Anti-Human CLDN18.2 Antibody (SAA0138), PE
MBS1584382-02 100 Tests

Anti-Human CLDN18.2 Antibody (SAA0138), PE

Sign In for Pricing
View Details
Anti-Human CLDN18.2 Antibody (SAA0138), PE
MBS1584382-03 5x 100 Tests

Anti-Human CLDN18.2 Antibody (SAA0138), PE

Sign In for Pricing
View Details
Lentiviral mouse S100a1 shRNA (UAS) - Lentiviral mouse S100a1 shRNA (UAS) (100)
GTR15279834 1 Vial

Lentiviral mouse S100a1 shRNA (UAS) - Lentiviral mouse S100a1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-HLA-A2-peptide (FMNKFIYEI) Complex (AMC-50)
RHM03030 100 μg

Anti-HLA-A2-peptide (FMNKFIYEI) Complex (AMC-50)

Sign In for Pricing
View Details
NUAK2 Rabbit Polyclonal Antibody (FITC)
orb103134 100 µL

NUAK2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details