Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FANK1 protein

This Human FANK1 protein spans the amino acid sequence from region 1-345aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FANK1

UniProt

Q8TC84

Expression Region

1-345aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vav3 Mouse Gene Knockout Kit (CRISPR)
KN518863 1 Kit

Vav3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX10 (SOX10/991), CF740 conjugate, 0.1mg/mL
BNC740991-500 1x 500 µL

SOX10 (SOX10/991), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMA7 Rabbit Polyclonal Antibody
HA500004 100 µL

PSMA7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS711069 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Casd1 Mouse Gene Knockout Kit (CRISPR)
KN502558 1 Kit

Casd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF640R conjugate, 0.1mg/mL
BNC400914-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details