Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VWA5B2 protein

This Human VWA5B2 protein spans the amino acid sequence from region 781-862aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VWA5B2

UniProt

Q8N398

Expression Region

781-862aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH2 Polyclonal Antibody, FITC Conjugated
bs-3947R-FITC 100 µL

IDH2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SRC1 Antibody [Allophycocyanin]
NB100-312APC 0.1 mL

Rabbit Polyclonal SRC1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
TRAFD1 siRNA (Human)
MBS8201195-01 15 nmol

TRAFD1 siRNA (Human)

Sign In for Pricing
View Details
TRAFD1 siRNA (Human)
MBS8201195-02 30 nmol

TRAFD1 siRNA (Human)

Sign In for Pricing
View Details
TRAFD1 siRNA (Human)
MBS8201195-03 5x 30 nmol

TRAFD1 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2), partial
MBS7059217 Inquire

Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2), partial

Sign In for Pricing
View Details