Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VWA5B2 protein

This Human VWA5B2 protein spans the amino acid sequence from region 781-862aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VWA5B2

UniProt

Q8N398

Expression Region

781-862aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat rno-miR-6216 miRNA Antagomir
abx890426-01 10 nmol

Rat rno-miR-6216 miRNA Antagomir

Sign In for Pricing
View Details
Rat rno-miR-6216 miRNA Antagomir
abx890426-02 20 nmol

Rat rno-miR-6216 miRNA Antagomir

Sign In for Pricing
View Details
CYB561D2 (NM_001291284) Human Tagged ORF Clone
RC236686 10 µg

CYB561D2 (NM_001291284) Human Tagged ORF Clone

Sign In for Pricing
View Details
Hsd17b10 Rat shRNA Lentiviral Particle (Locus ID 63864)
TL711481V 500 µL Each

Hsd17b10 Rat shRNA Lentiviral Particle (Locus ID 63864)

Sign In for Pricing
View Details
KATNAL2 Antibody, FITC conjugated
A60797-100UG 100 µg

KATNAL2 Antibody, FITC conjugated

Sign In for Pricing
View Details
MORF4L1 Antibody
CSB-PA146109-01 50 μL

MORF4L1 Antibody

Sign In for Pricing
View Details