Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NXNL2 protein

This Human NXNL2 protein spans the amino acid sequence from region 1-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NXNL2

UniProt

Q5VZ03

Expression Region

1-135aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4657 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV769706 1.0 µg DNA

MIR4657 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
MFSD4A Antibody
A65017-50UG 50 µg

MFSD4A Antibody

Sign In for Pricing
View Details
3-[ (1-Phenylethyl) amino]-1-propanol
423400-01 100 mg

3-[ (1-Phenylethyl) amino]-1-propanol

Sign In for Pricing
View Details
3-[ (1-Phenylethyl) amino]-1-propanol
423400-02 250 mg

3-[ (1-Phenylethyl) amino]-1-propanol

Sign In for Pricing
View Details
Ioxitalamic Acid
M27163-01 1 g

Ioxitalamic Acid

Sign In for Pricing
View Details
Ioxitalamic Acid
M27163-02 500 mg

Ioxitalamic Acid

Sign In for Pricing
View Details