Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMUG1 protein

This Human SMUG1 protein spans the amino acid sequence from region 1-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SMUG1

UniProt

Q53HV7

Expression Region

1-177aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borrelia garinii Antigen
orb533709 1 mg

Borrelia garinii Antigen

Sign In for Pricing
View Details
Fmoc-Asn(Trt)-Wang Resin (100-200 mesh) 1% DVB
MBS406600-01 1 g

Fmoc-Asn(Trt)-Wang Resin (100-200 mesh) 1% DVB

Sign In for Pricing
View Details
Fmoc-Asn(Trt)-Wang Resin (100-200 mesh) 1% DVB
MBS406600-02 5 g

Fmoc-Asn(Trt)-Wang Resin (100-200 mesh) 1% DVB

Sign In for Pricing
View Details
Fmoc-Asn(Trt)-Wang Resin (100-200 mesh) 1% DVB
MBS406600-03 5x 5 g

Fmoc-Asn(Trt)-Wang Resin (100-200 mesh) 1% DVB

Sign In for Pricing
View Details
V-ATPase B1 Antibody
OM636382-01 100 µL

V-ATPase B1 Antibody

Sign In for Pricing
View Details
V-ATPase B1 Antibody
OM636382-02 20 µL

V-ATPase B1 Antibody

Sign In for Pricing
View Details