Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ST3GAL3 protein

This Human ST3GAL3 protein spans the amino acid sequence from region 29-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ST3GAL3

UniProt

Q11203

Expression Region

29-375aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brassica napus Oleosin S2-2 (S2)
MBS7029218-01 0.02 mg

Recombinant Brassica napus Oleosin S2-2 (S2)

Sign In for Pricing
View Details
Recombinant Brassica napus Oleosin S2-2 (S2)
MBS7029218-02 0.1 mg

Recombinant Brassica napus Oleosin S2-2 (S2)

Sign In for Pricing
View Details
Recombinant Brassica napus Oleosin S2-2 (S2)
MBS7029218-03 5x 0.1 mg

Recombinant Brassica napus Oleosin S2-2 (S2)

Sign In for Pricing
View Details
IL13 Rabbit Polyclonal Antibody (Cy5)
orb913195 100 µL

IL13 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Scyliorhinin II
orb1679486-01 1 mg

Scyliorhinin II

Sign In for Pricing
View Details
Scyliorhinin II
orb1679486-02 5 mg

Scyliorhinin II

Sign In for Pricing
View Details