Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli lepB protein

This E.coli lepB protein spans the amino acid sequence from region 88-294aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LepB

UniProt

P9WKA1

Expression Region

88-294aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFRAL Protein (C-Fc, Human)
P504193 100 µg

GFRAL Protein (C-Fc, Human)

Sign In for Pricing
View Details
EXOSC5 (Biotin)
561885-01 50 µg

EXOSC5 (Biotin)

Sign In for Pricing
View Details
EXOSC5 (Biotin)
561885-02 100 µg

EXOSC5 (Biotin)

Sign In for Pricing
View Details
TLR9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1573236 100 µL

TLR9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
NT5C (5'(3')-deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (MaxLight 650)
MBS6387664-01 0.1 mL

NT5C (5'(3')-deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (MaxLight 650)

Sign In for Pricing
View Details
NT5C (5'(3')-deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (MaxLight 650)
MBS6387664-02 5x 0.1 mL

NT5C (5'(3')-deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (MaxLight 650)

Sign In for Pricing
View Details