Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fhit protein

This Mouse Fhit protein spans the amino acid sequence from region 2-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fhit

UniProt

O89106

Expression Region

2-150aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAb to S. Typhi
MBS313528-01 1 mg

MAb to S. Typhi

Sign In for Pricing
View Details
MAb to S. Typhi
MBS313528-02 5x 1 mg

MAb to S. Typhi

Sign In for Pricing
View Details
FAM48B2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20043061 1.0 µg DNA

FAM48B2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2,2-Dimethyl-1- (4-phenoxyphenyl) -1-propanone
OR1092840-01 250 mg

2,2-Dimethyl-1- (4-phenoxyphenyl) -1-propanone

Sign In for Pricing
View Details
2,2-Dimethyl-1- (4-phenoxyphenyl) -1-propanone
OR1092840-02 500 mg

2,2-Dimethyl-1- (4-phenoxyphenyl) -1-propanone

Sign In for Pricing
View Details
2,2-Dimethyl-1- (4-phenoxyphenyl) -1-propanone
OR1092840-03 1 g

2,2-Dimethyl-1- (4-phenoxyphenyl) -1-propanone

Sign In for Pricing
View Details