Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli SVTLE protein

This E.coli SVTLE protein spans the amino acid sequence from region 25-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SVTLE

UniProt

F8S114

Expression Region

25-262aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Crotalus adamanteus (Eastern diamondback rattlesnake)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfosuccinimidyl oleate sodium
T13036L-01 1 mg

Sulfosuccinimidyl oleate sodium

Sign In for Pricing
View Details
Sulfosuccinimidyl oleate sodium
T13036L-02 5 mg

Sulfosuccinimidyl oleate sodium

Sign In for Pricing
View Details
Sulfosuccinimidyl oleate sodium
T13036L-03 10 mg

Sulfosuccinimidyl oleate sodium

Sign In for Pricing
View Details
Sulfosuccinimidyl oleate sodium
T13036L-04 25 mg

Sulfosuccinimidyl oleate sodium

Sign In for Pricing
View Details
Sulfosuccinimidyl oleate sodium
T13036L-05 50 mg

Sulfosuccinimidyl oleate sodium

Sign In for Pricing
View Details
Sulfosuccinimidyl oleate sodium
T13036L-06 100 mg

Sulfosuccinimidyl oleate sodium

Sign In for Pricing
View Details