Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A6 protein

This Human COL6A6 protein spans the amino acid sequence from region 430-982aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COL6A6

UniProt

A6NMZ7

Expression Region

430-982aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

77.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3 (Protein Phosphatase Slingshot Homolog 3, SSH-like Protein 3, SSH3L, SSH-3L, hSSH-3L) (MaxLight 405) discontinued
133865-ML405 100 µL

SSH3 (Protein Phosphatase Slingshot Homolog 3, SSH-like Protein 3, SSH3L, SSH-3L, hSSH-3L) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Elk1(Phospho-Thr417) Antibody
MBS9410621-01 0.05 mL

Elk1(Phospho-Thr417) Antibody

Sign In for Pricing
View Details
Elk1(Phospho-Thr417) Antibody
MBS9410621-02 0.1 mL

Elk1(Phospho-Thr417) Antibody

Sign In for Pricing
View Details
Elk1(Phospho-Thr417) Antibody
MBS9410621-03 5x 0.1 mL

Elk1(Phospho-Thr417) Antibody

Sign In for Pricing
View Details
Anti-LGR5 Antibody Picoband®, PE Conjugate
A00239-2-PE 100 µg/Vial

Anti-LGR5 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
CRTAC1 Rabbit pAb, BF700 conjugated
orb2840176 100 µL

CRTAC1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details