Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli aglB protein

This E.coli aglB protein spans the amino acid sequence from region 21-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AglB

UniProt

A2QEJ9

Expression Region

21-443aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDA receptor antagonist 2
MBS5801148 Inquire

NMDA receptor antagonist 2

Sign In for Pricing
View Details
Lentiviral mouse 5730409E04Rik shRNA (UAS) - Lentiviral mouse 5730409E04Rik shRNA (UAS) (25)
GTR15143225 1 Vial

Lentiviral mouse 5730409E04Rik shRNA (UAS) - Lentiviral mouse 5730409E04Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal LIMD2 Antibody
NBP3-21295-25ul 25 µL

Rabbit Polyclonal LIMD2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SUV39H2 Antibody [Biotin]
NBP2-98968B 0.1 mL

Rabbit Polyclonal SUV39H2 Antibody [Biotin]

Sign In for Pricing
View Details
Zfp90 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3945708 1.0 µg DNA

Zfp90 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FUBP1 Rabbit Polyclonal Antibody (BF405)
orb2526714 100 µL

FUBP1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details