Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli aglB protein

This E.coli aglB protein spans the amino acid sequence from region 21-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AglB

UniProt

A2QEJ9

Expression Region

21-443aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Secretagogin (SCGN, SECRET, SEGN, CALBL, DJ501N12.8, Setagin)
133006 50 µg

Secretagogin (SCGN, SECRET, SEGN, CALBL, DJ501N12.8, Setagin)

Sign In for Pricing
View Details
Human hsa-miR-499a-3p miRNA Agomir
abx880606-01 5 nmol

Human hsa-miR-499a-3p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-499a-3p miRNA Agomir
abx880606-02 10 nmol

Human hsa-miR-499a-3p miRNA Agomir

Sign In for Pricing
View Details
RPL23AP20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
41143111 3x 1.0 µg

RPL23AP20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Francisella tularensis IgM ELISA Kit
MBS495359-01 96 Tests

Francisella tularensis IgM ELISA Kit

Sign In for Pricing
View Details
Francisella tularensis IgM ELISA Kit
MBS495359-02 5x 96 Tests

Francisella tularensis IgM ELISA Kit

Sign In for Pricing
View Details