Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli entC1 protein

This E.coli entC1 protein spans the amino acid sequence from region 28-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EntC1

UniProt

P01553

Expression Region

28-266aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESQPDPTPDELHKASKFTGLMENMKVLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEGLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1305420 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
38938116 3x 1.0 µg

RGD1305420 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human OR5H14 shRNA (UAS) - Lentiviral human OR5H14 shRNA (UAS) (100)
GTR15335841 1 Vial

Lentiviral human OR5H14 shRNA (UAS) - Lentiviral human OR5H14 shRNA (UAS) (100)

Sign In for Pricing
View Details
Pih1d2 ORF Vector (Rat) (pORF)
ORF073509 1.0 µg DNA

Pih1d2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Hsa-miR-7106-3p miRNA Mimic
CMH2456-01 5 nmol

Hsa-miR-7106-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-7106-3p miRNA Mimic
CMH2456-02 10 nmol

Hsa-miR-7106-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Human IL-17A
P0797-01 50 µg

Recombinant Human IL-17A

Sign In for Pricing
View Details