Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli entC1 protein

This E.coli entC1 protein spans the amino acid sequence from region 28-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EntC1

UniProt

P01553

Expression Region

28-266aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESQPDPTPDELHKASKFTGLMENMKVLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEGLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maoa Mouse shRNA Lentiviral Particle (Locus ID 17161)
TL501299V 500 µL Each

Maoa Mouse shRNA Lentiviral Particle (Locus ID 17161)

Sign In for Pricing
View Details
Synphilin-1 (F-9) HRP
sc-365741 HRP 200 µg/mL

Synphilin-1 (F-9) HRP

Sign In for Pricing
View Details
CSTL1 antibody
70R-21499 50 μL

CSTL1 antibody

Sign In for Pricing
View Details
Mouse Complement Fragment 5a (C5a) ELISA Kit
JL10267-01 48 Tests

Mouse Complement Fragment 5a (C5a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Fragment 5a (C5a) ELISA Kit
JL10267-02 96 Tests

Mouse Complement Fragment 5a (C5a) ELISA Kit

Sign In for Pricing
View Details
FAR2 siRNA (Mouse)
orb1834647-01 15 nmol

FAR2 siRNA (Mouse)

Sign In for Pricing
View Details