Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli entG protein

This E.coli entG protein spans the amino acid sequence from region 26-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EntG

UniProt

P0A0L6

Expression Region

26-258aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18P15 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV766202 1.0 µg DNA

KRT18P15 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Olr810 Protein Vector (Rat) (pPM-C-HA)
34702026 500 ng

Olr810 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
OR5G3 Protein Vector (Human) (pPB-N-His)
PV107983 500 ng

OR5G3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Cysltr1 Mouse siRNA Oligo Duplex (Locus ID 58861)
SR426502 1 Kit

Cysltr1 Mouse siRNA Oligo Duplex (Locus ID 58861)

Sign In for Pricing
View Details
Riok3 (NM_024182) Mouse Tagged Lenti ORF Clone
MR208314L3 10 µg

Riok3 (NM_024182) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rnf133 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6567303 1.0 µg DNA

Rnf133 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details