Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli entG protein

This E.coli entG protein spans the amino acid sequence from region 26-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EntG

UniProt

P0A0L6

Expression Region

26-258aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Methyl-1H-pyrrolo[2,3-b]pyridine-6-carboxylic acid
NQC76099 1 g

4-Methyl-1H-pyrrolo[2,3-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
ROBO3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1867808 1.0 µg DNA

ROBO3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Gm2799 3'UTR Luciferase Stable Cell Line
TU107870 1.0 mL

Gm2799 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KLRG1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62195R-PE-Cy7 100 µL

KLRG1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase HECW2 (HECW2) Antibody
abx349507-01 20 µg

E3 ubiquitin-protein ligase HECW2 (HECW2) Antibody

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase HECW2 (HECW2) Antibody
abx349507-02 50 µg

E3 ubiquitin-protein ligase HECW2 (HECW2) Antibody

Sign In for Pricing
View Details