Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ftsZ protein

This E. coli ftsZ protein spans the amino acid sequence from region 1-383aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FtsZ

UniProt

P0A9A7

Expression Region

1-383aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit
MBS7219653-01 48 Well

Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit
MBS7219653-02 96 Well

Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit
MBS7219653-03 5x 96 Well

Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit
MBS7219653-04 10x 96 Well

Chicken Angiopoietin-related protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
MKRN1 Human Pre-designed siRNA Set A
HY-RS08479 1 Set

MKRN1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Collagen VII Antibody [K3G14]
F3214-100uL*2 2x 100 μL

Collagen VII Antibody [K3G14]

Sign In for Pricing
View Details