Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli SEH protein

This E.coli SEH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEH

UniProt

P0A0M0

Expression Region

25-241aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plppr1 (NM_178756) Mouse Recombinant Protein
PM43882M5 20 µg

Plppr1 (NM_178756) Mouse Recombinant Protein

Sign In for Pricing
View Details
Anti-Transglutaminase 4 Antibody
MBS8308386-01 0.03 mL

Anti-Transglutaminase 4 Antibody

Sign In for Pricing
View Details
Anti-Transglutaminase 4 Antibody
MBS8308386-02 0.05 mL

Anti-Transglutaminase 4 Antibody

Sign In for Pricing
View Details
Anti-Transglutaminase 4 Antibody
MBS8308386-03 0.1 mL

Anti-Transglutaminase 4 Antibody

Sign In for Pricing
View Details
Anti-Transglutaminase 4 Antibody
MBS8308386-04 0.2 mL

Anti-Transglutaminase 4 Antibody

Sign In for Pricing
View Details
Anti-Transglutaminase 4 Antibody
MBS8308386-05 5x 0.2 mL

Anti-Transglutaminase 4 Antibody

Sign In for Pricing
View Details