Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Histone H2B protein

This E.coli Histone H2B protein spans the amino acid sequence from region 2-93aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B

UniProt

P14001

Expression Region

2-93aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Cairina moschata (Muscovy duck)

Field of Research

Infectious Disease & Virology; Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody
APRab00919-01 20 µL

Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody
APRab00919-02 50 µL

Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody
APRab00919-03 100 µL

Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody
APRab00919-04 200 µL

Phospho-Stathmin 1 (Ser25) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AdmiRa-mmu-miR-598-5p Virus
mm1478 250 µL

AdmiRa-mmu-miR-598-5p Virus

Sign In for Pricing
View Details
EphA2 Receptor (Ephrin A2 Receptor, EphA2, EPHA2, EPH Receptor A2) (HRP)
E3360-02B-HRP 100 µL

EphA2 Receptor (Ephrin A2 Receptor, EphA2, EPHA2, EPH Receptor A2) (HRP)

Sign In for Pricing
View Details