E.coli Histone H2B protein
This E.coli Histone H2B protein spans the amino acid sequence from region 2-93aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Histone H2B
UniProt
P14001
Expression Region
2-93aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Cairina moschata (Muscovy duck)
Field of Research
Infectious Disease & Virology; Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
226453-01 50 µL
TRIM21 (52kD Ribonucleoprotein Autoantigen Ro/SS-A, 52kD Ro Protein, 52kD Ro/SSA Autoantigen, Autoantigen Ro/SSA, 52-KD, E3 Ubiquitin-Protein Ligase TRIM21, RING Finger Protein 81, RNF81, Ro 52, Ro (SS-A), Ro52, RO52_HUMAN, Sicca Syndrome Antigen A, Sjoegren Syndrome Type A Antigen, Sjogren Syndrome Antigen A1, Sjogren Syndrome Type A Antigen, SS-A, SSA, SSA1: Sjogren Syndrome Antigen A1 (52kDa Ribonucleoprotein Autoantigen SS-A/Ro), TRIM21, Tripartite Motif Protein TRIM21, Tripartite Motif-Containing 21, Tripartite Motif-Containing Protein 21, ) discontinued
Sign In for Pricing
View Details 226453-02 100 µL
TRIM21 (52kD Ribonucleoprotein Autoantigen Ro/SS-A, 52kD Ro Protein, 52kD Ro/SSA Autoantigen, Autoantigen Ro/SSA, 52-KD, E3 Ubiquitin-Protein Ligase TRIM21, RING Finger Protein 81, RNF81, Ro 52, Ro (SS-A), Ro52, RO52_HUMAN, Sicca Syndrome Antigen A, Sjoegren Syndrome Type A Antigen, Sjogren Syndrome Antigen A1, Sjogren Syndrome Type A Antigen, SS-A, SSA, SSA1: Sjogren Syndrome Antigen A1 (52kDa Ribonucleoprotein Autoantigen SS-A/Ro), TRIM21, Tripartite Motif Protein TRIM21, Tripartite Motif-Containing 21, Tripartite Motif-Containing Protein 21, ) discontinued
Sign In for Pricing
View Details 
